Top 10k strings from 16-48 Magazine - Issue 17 (1985)(16-48 Tape Magazine).tap
in <root> / bin / z80 / software / Sinclair Spectrum Collection TOSEC.exe / Sinclair ZX Spectrum - Magazines / Sinclair ZX Spectrum - Magazines - [TAP] (TOSEC-v2007-01-01) /
Back to the directory listing
9 GGGGGGGGGGGGGGGG 5 B.C.THORNE APRIL 1983*S\ 5 ;" ": 5 444444444444444444444444444444 4 gazine Ltd. *6\$: 4 UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU 4 STOP THE TAPE 4 RUN THE TAPE 4 88888888888888888888888888888888 4 33333333333` 4 16/48 script 4 ((prog+474 4 16/48 Magazine Ltd. *6\$: 3 z$="11000404A": 3 z$="10030203STOP THE TAPE": 3 z$="10030203RUN THE TAPE": 3 z$="09020203STOP THE TAPE": 3 z$="07000404Q": 3 a$,"Step by step programming: ZX 3 MEDIOCRE!": 3 LET THE TAPE RUN 3 FANTASTIC!": 3 ;"SYMBOLS" 3 ;"SHERLOCK 3 ;"Ludoid4 3 ;"16/48D&G17": 3 ;" ": 3 888888888888 3 23635+256* 3 0000000000000000000000000000 3 (STX-FNX): 3 "Nothing happens": 3 "");(w$(i) 3 2 z$="10020203RUN THE TAPE": 2 mmmmmmmmmmmmm 2 caps,viii: 2 agazine Ltd*S\ 2 a$(i)>q$(i) 2 Z$="10030203RUN THE TAPE": 2 UUUUUUUUUU 2 Press any key 2 PRESS ANY KEY 2 PRESS A KEY 2 C$=Q$(Q+I,W+I) 2 Argus Press 2 A$="CHEST": 2 ;"tutor8": 2 ;"PRESS A KEY ( 2 ;"MAY 1985" 2 ;"FIG CODE" 2 ;"CROSSWORD": 2 ;"BULLETIN": 2 ;"16/48TITLE" 2 ;" " 2 8888888888888 2 )))))))111111111111111111))))))))))))11111000000000000001111)))))))11000000000000000000000111))))1110000000000000000000000111)))111000000000000000000000000011111000000000000000000000000000011100000000000000000000000000000011000000000000000000000220000000110000000000000000000022222000000100000000000000000000222220000001000000000000000000000222000000010000000000000000000000000000000100000000000000000000000000000001000000000000000000000000000000010000000000000000000000000000000100000000000000000000000000000001000000000000000x000000000000000110000000000000000000000000000001100000000000000000000000000000011100000000000000000000000000001111000000000000000000000000000011) 2 ((prog+168 2 $8888888888888888888888888888888888888888888888888888888888888888888888 2 "You cannot": 2 "SHERLOCK 2 "PROG+239", 2 "I cannot help you": 2 "20")="d": 2 "0";" ": 2 "0",XPR;Z$;")": 2 1984 A.P.S. 2 PROGRAM: A.K.S. & Psion MEMORY: 16K or 48K PRICE: `4.95 PUBLISHER: SINCLAIR Sinclair Research Ltd. Stanhope Road Camberley Surrey GU15 3PS. 2 % 2 ": 1 ~hhflh~lhl 1 z$="llcchhvv": 1 z$="ll130201AND ": 1 z$="ll020302GREEN MEN": 1 z$="ll000402DUNGEONS": 1 z$="The format for each entry is:": 1 z$="TITLE": 1 z$="Sources of reference:": 1 z$="SUBJECT": 1 z$="PUBLISHER": 1 z$="How to use it...": 1 z$="ENTER": 1 z$="DONE": 1 z$="BOOKLIST for the ZX SPECTRUM": 1 z$="AUTHOR": 1 z$="19000203CONGRATULATIONS!": 1 z$="18cchh04"+c$: 1 z$="18010202DISPLAY SCROLL": 1 z$="15000204Q to quit.": 1 z$="15000203M to move on.": 1 z$="13030305CHAPTER 8": 1 z$="13000404A": 1 z$="12000204Let the tape run": 1 z$="11250103Cyclapes": 1 z$="11060203Ludoids": 1 z$="10000202Let the tape run": 1 z$="09000404Q": 1 z$="08240102Chapter 4": 1 z$="08040303SNOWBALL": 1 z$="07060201HELP MENU": 1 z$="07010202SHERLOCK SLEUTH": 1 z$="06070105MACHINE CODE TUTOR": 1 z$="06050202BIT n,r": 1 z$="06010202HELP IS AT HAND": 1 z$="05000304YOU GO NOW": 1 z$="05000204R to run again,": 1 z$="05000203R to go again,": 1 z$="04070202PRESENTS": 1 z$="0310020216/48": 1 z$="02cchh04"+a$: 1 z$="00140201OF": 1 z$="0007030316/48": 1 z$="00050102WHAT'S IT ALL ABOUT?": 1 z$="00030202OTHER POINTS": 1 z$="00030103MESSAGE SCROLLING ROUTINE": 1 z$="00020202PRESSING KEYS": 1 z$="00010302OTHER TIPS": 1 z$="00010202NOW IN Z80 CODE": 1 z$="00010102WHERE ARE THE KEYBOARD PORTS?": 1 z$="00000805EDIT": 1 z$="0000060516 48": 1 z$="00000402USING IN": 1 z$="00000402THE BITS": 1 z$="00000202THAT'S ALL FOLKS": 1 z$="00000202TESTING THE BITS": 1 z$=" PRESS...": 1 z$=" Be warned...": 1 z$(z)-xxxii: 1 your "+c$,vi,"4",e3,4.75 1 you purists adventurers out 1 y$="You see ": 1 y$=" ": 1 xxxii=xxx+ii: 1 xxxi=xxx+i: 1 x,y;b$(n);: 1 x"'"POKE 23606,x-256* 1 workbook",vii,"8",e4,n8,"084747 9",vi,o 1 will appear to help those with 1 w=w+(Q$(q+1 1 viii=vii+i: 1 viii,v;"for printer output."; 1 vi;pt-ii;" record";("s" 1 variety of Watch-Gnomes as well as other unspeakable nasty things and substances. To achieve access to some rooms you will need to resort to using mouse holes. This becomes a game of timing as you leap from pulsating 1 variables for common years, 1 u$,"`";p;("0" 1 tutor8 1 trying to decode the notes, 1 transport, Snowball 9, as a 1 to safeguard the interstar 1 to quit."; 1 to Re-read"''" 1 they should fit onto A4 paper 1 there. It is also massive with 1 the keys to Basil's and Tricia'sLondon flats are. Well there 1 the concluding episode 1 the absolute beginner",viii,"9",e2,n6,"110 1",i,d 1 the ZX "+c$,o,"6",e2,n4,"17 1",i,d 1 the "+c$,ii,"20",e4,n3,"007815 0",i,5.84 1 teachers & parents",v,"15",e3,n6,"14 5",i,d 1 t$=t$+".": 1 t$="ansew00 #00000000GdjbB00" 1 t$,s,p$,y,p,i$,b,db: 1 strip it from search key & set 1 story line. which could easily 1 still be in the correct lane at every half kilometre mark. There are4 levels of difficulty and you can choose which numeric operator to practice. 5 year olds mayfind the game a bit too sophisticated. EXCELLENT 1 start ~ gives a fast~soft~ start. 1 starship has been hijacked 1 spell that we have just had.": 1 software for the "+c$,ii,"1",e3,n5,"0264 X",i,d 1 skip rest of print routine 1 single button, a help menu 1 show how much (how little?) 1 sheeting on Timex/"+d$+" 2000 and "+d$+" ZX "+c$,i,"8",e3,18 1 see that the main character, 1 scroll=1013 1 screen and according to the displayed countdown clock we still had 200 seconds of loading time to go!! That is clever! The game itself is of theJet Set Willy kind, but of a superior programmingstandard. 1 sabotage.": 1 routines in Timex/"+d$+" 1 rev6 X 1 rev5 1 rev4 1 rev3 1 rev2 5 1 rev1 \ 1 put searching or printing 1 put common publishers & ISBN 1 publisher's name from string 1 projects",iv,"8",e3,n6,"084702 9",i,d 1 programs. Vol 1",ii,"12",e2,n5,"00 9",i,d 1 programs",vi,"8",e4,n7,"084729 0",i,d 1 programs",vi,"14",e4,n1,"132 1",ii,11284 1 programs for "+c$+" & ZX81",vi,"6",e2,3.25 1 programming",iii,"9",e3,n7,"111 X",i,d 1 programming guide",iii,"21",e4,2.5 1 programming book.(For children)",v,"4",e4,n4,"01233 0",i,d 1 programmers",v,"8",e4,n5,"084738 X",ii,101184 1 program",o,"7Granada586",e3,n2,"06104 5",i,d 1 program that every true 1 prog+730,"; 1 processing & beyond",i,"8",e3,n6,"084704 5",i,d 1 print pub, price, 1 print end message on hardcopy 1 print author & title 1 prices, etc. 1 prefixes into string array 1 practical subroutines and 1 piston to pulsating piston with a wet grave only a hair's breadth away. The background graphics are superb, but the sprites are a bit rough and suffer from attribute clashing. In all a bit confusing. Bring back Monty. 1 page to 5, else set to 3 1 p3,viii*xp: 1 p$="1122334455667722744": 1 p$(i)+i)<vl 1 over 7000 locations, 700 1 numbers on them. Each time you select a box your total will change. The game element is enhanced by the fact thatyour painter can never stop and there are lethalgaps between the girders which must be avoided. 1 novel. In fact, I think it oftenhas.": 1 not longer than field being 1 n,o;" ": 1 most from it",o,"5",e2,n5,"12018 5",i,d 1 modified. Can you save the 1 micro"+e$+"s",ix,"5Sigma905104",e4,n6,"49 8",vi,o 1 micro h 1 messages, a 200 word vocabulary 1 messages at bottom of screen 1 message scroll 1 memory remaining 1 make the basis of a good S.F. 1 main subroutine to display a$, b$ and c$. 1 mail V 1 m:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc 1 look for ~+~, 1 last resort following 1 language",viii,"9",e4,n6,"160 8",i,d 1 l=l+(k$="6" 1 l$="--------------------------------": 1 l$''"---cut---cut---cut---cut---cut--"''l$: 1 k$=k$+a$(n) 1 ix;n+iii;" "; 1 ix,v;"(Uses a LOT of paper!)."; 1 intelligence on your "+c$+"+ 1 insect sporting calendar.Wriggler is an arcade/ adventure in which the player is cast as a defenceless maggot.Your task is to compete against grubs of your ownkind in a race where it is not winning, but survival which counts! 1 initialise big print routine 1 ii;w$(n+v): 1 if short screen output, set 1 if short screen output, 1 if publisher datais a no., use it to get array 1 if past approp author data, 1 if no publisher match, goto read 1 if no author match gotoread 1 if author search jump to approp. data line 1 i;n-ii;" "; 1 i);" found.",: 1 i);" found. 1 hours on your ZX "+c$,v,"1",e4,n2,"0410 3",i,d 1 home. For those of you who are 1 hidden door 1 hhjjjjjjjjGGGGG 1 hhjjjjjjjjGGGG 1 have to wait until they come 1 giving most problems this 1 games",vi,"16",e4,n3,"636882 4",ii,151284 1 games",vi,"10",e4,n3,"28457 6",i,d 1 games and other fast "+c$+" 1 for your ZX "+c$,vi,"5Corgi552",e4,n4,"99129 5",ii,171184 1 for the "+c$+", ZX81 and other"+e$+"s",iv,"6",e4,6.45 1 ff`bffbffbf 1 facing for the "+c$,iv,"5",e4,n5,"12576 4",ii,110884 1 f<bbffb<fbf 1 f,o;" ": 1 f$="SEARCHING...": 1 f$="PRINTING...": 1 extraordinary. Your mission: 1 ensure that 1 ensure publisher search key is 1 education on the "+d$+" ZX81. With "+c$+" suppt. ( 1 edit 1 ed",v,"5",e4,n1,"12592 6",iv,o 1 e$="computer": 1 dittosubject headings 1 ditto title match 1 ditto title field 1 ditto subject 1 disassembly",viii,"9",e3,n9,"116 0",i,d 1 deeper into your ZX "+c$,iii,"6",e3,n7,"24 4",i,d 1 date, ISBN and ref 1 d$="nsew": 1 d$="n w": 1 d$="Sinclair": 1 d$="19010203THEN READ ON..." 1 d$=" sew": 1 course: complete "+d$+" BASIC"+" manual for ZX81/"+c$+" users",iii,"1",e3,n9,"0073 6",i,d 1 course for the "+c$,iii,"1",e5,n9,"0380 8",vi,o 1 convenient common variables 1 computing: the ZX "+c$,o,"1",e3,n6,"0332 8",i,d 1 compiled.": 1 comp17 1 commonly used strings into vars 1 code",viii,"5",e3,n5,"12082 7",i,d 1 catastrophic accident or 1 c=c+(k$="8" 1 c$=q$(n,m) 1 c$="Spectrum": 1 c$="15010103QNB'V THNG USAK???": 1 c$="--------": 1 being awakened from hibernation.The five mile long colony 1 b$="letter words only": 1 b$="Welcome to chapter 4 of THE LUDOIDS | ": 1 b$="This month youare following the LUDOIDS | to the planet MOUNT CYCLO": 1 b$="ENTER the code from last months game (OR hit ENTER)": 1 b$="Do you want a print out (y/n)": 1 b$="Do you want instructions ? (y/n)": 1 b$="11010103ONLY 6999 LOCATIONS TO GO??": 1 b$=" ** DON'T FORGET ** 1 b$(vi,vii): 1 author search key is not longer than field being searched 1 aren't any. You will simply 1 applications",viii,"12",e3,n6,"17 3",i,d 1 applic'ns of ZX81/"+c$+"..",ix,p$,e3,ix,"07 0",i,d 1 and sabotaged; its robots 1 and message texts are detailed 1 and games for the "+d$+" 1 and atmospheric. The vocabulary is extensive and intelligently 1 and about 60 objects. Location 1 and "+c$,iii,"9Interface947695",e4,n6,"05 2",ii,221284 1 also makes a nice change to 1 ago, and I'm eagerly awaiting 1 agazine Ltd. *6\$: 1 adventures is the excellent 1 adventurer should attempt. It 1 adventure which should please 1 achieve a stated target number. at the top of thescreen are two numbers - the target number and your total number. The object of the game is to make your total number equal the target number by painting the boxes which have operators and 1 a$="take this opportunity to" 1 a$="solve the jumbled pictures!!!": 1 a$="routine in #12. ": 1 a$="readers :- ": 1 a$="product that you have developed": 1 a$="frustrated competition fans.": 1 a$="for many of us BASIC bashers.": 1 a$="excellent and innovative": 1 a$="courtesy of your 'ZOUNDS' ": 1 a$="an animated sequence HOW to ": 1 a$="The light is beginning to dawn": 1 a$="TREE": 1 a$="SCORP": 1 a$="SAND": 1 a$="MACHINE CODE TUTOR series. ": 1 a$="I have even been spurred to use": 1 a$="Finally some points for the ": 1 a$="DETEC": 1 a$="Can you please show by means of": 1 a$="CYCL": 1 a$="CHEST": 1 a$="And now a PLEA on behalf of all": 1 a$="1. THE CODE FOR THE SOUNDS USED": 1 a$="07010103MELTING SNOWBALL?": 1 a$="(Maybe next month!? Ed.)": 1 a$=" PRESS ANY KEY TO CONTINUE": 1 a$=" Now that 1985 is here may I": 1 a$=" " 1 a$=" 1 a$,c$+" workshop: word 1 a$,c$+" supergames",vi,"18",e4,n5,"0017 5",i,d 1 a$,c$+" subroutines",ii,"3",e4,n6,"1856 3",ii,110884 1 a$,c$+" spectacular:50 programsfor the "+d$+" "+c$,ii,p$,e2,n4,"03 5",i,d 1 a$,c$+" programs",ii,"3",e3,n6,"1704 4",i,d 1 a$,c$+" machine code",viii,"11",e3,n5,"35 6",i,d 1 a$,c$+" in education",v,"11",e3,6.5 1 a$,c$+" graphics machine",vii,"8",e4,n5,"084768 1",vi,o 1 a$,c$+" games",vi,"3",e4,n6,"1819 9",ii,110884 1 a$,c$+" add-on guide",iv,"5",e4,n5,"12563 2",i,d 1 a$,"ZX "+c$+": how to use and 1 a$,"ZX "+c$+". (Beginners' Micro 1 a$,"ZX "+c$+" whizz kid",v,"7",e4,n4,"91608 9",ii,81284 1 a$,"ZX "+c$+" game master",vi,"7",e4,n3,"91606 2",ii,81284 1 a$,"ZX "+c$+" explored",o,"15",e2,n5,"00 5",i,d 1 a$,"ZX "+c$+" and how to get the 1 a$,"Young people's "+c$,v,"19",e3,n5,"399 7",i,d 1 a$,"Words and word games: "+c$+" 1 a$,"Which Micro "+c$+" handbook",o,"4Emap0",e4,4.99 1 a$,"Very basic BASIC"+": the first 15 1 a$,"Using graphics and sound on the "+c$,vii,"3",e4,n6,"1878 4",ii,110884 1 a$,"Understanding your "+c$+": 1 a$,"Turbocharge your ZX "+c$,o,"7",e4,n5,"91604 6",ii,81284 1 a$,"Supercharge your "+c$,viii,"9",e3,n6,"112 8",i,d 1 a$,"Step-by-step programming: ZX 1 a$,"Second steps with your "+c$,v,"16",e4,1.75 1 a$,"Pocket handbook for the 1 a$,"Pictures and animation: "+c$+"ed",v,"5",e4,n1,"12591 8",iv,o 1 a$,"PCW hints and tips: "+c$,o,"1",e4,n5,s$,iv,o 1 a$,"PCW BASIC"+" games collection: 1 a$,"New adventure systems for the 1 a$,"More graphic games for the 1 a$,"More adventures for your ZX 1 a$,"Micro maths: "+c$+" ed",v,"5",e4,n1,"12589 6",iv,o 1 a$,"Mathematics tutor for the 1 a$,"Mathematical & educ'l applic'ns of the ZX81 (or "+c$+")..",ix,p$,e3,ix,"06 2",i,d 1 a$,"Making the most of your "+c$+"Microdrives",iv,"18",e4,n5,"0005 1",i,d 1 a$,"Make the most of your ZX 1 a$,"Learning to use the ZX "+c$+".(See also last item)",o,"4Ginn602",e2,4.9 1 a$,"Instant "+c$+" programming. 1 a$,"Graphic adventures for the 1 a$,"Giant book of "+c$+" games",vi,"16",e3,n3,"636744 5",i,d 1 a$,"Giant book of "+c$+" arcade 1 a$,"Getting started on your 1 a$,"Gateway to computing: ZX 1 a$,"Games for your ZX "+c$,vi,"13",e3,n1,"84 7",i,d 1 a$,"Games ZX "+e$+"s play: 30 1 a$,"Further programming for the ZX 1 a$,"Further adventures on the 1 a$,"Exploring artificial 1 a$,"Exploring adventures on the 1 a$,"Expert guide to the "+c$,o,"5",e4,n6,"12278 1",i,d 1 a$,"Engineering & scientific 1 a$,"49 explosive games for the ZX 1 a$+" (ed)","25 new programs for the 1 a$+" & others",c$+" book of games",vi,"5",e2,n5,"12047 9",i,d 1 a$+" & others",c$+" advanced user guide",o,"5Adder947929",e4,n7,"02 9",ii,171184 1 a$+" & others","Complete "+d$+" database",o,"7Big Bro946990",e3,n6,"00 X",i,d 1 a$+" & SCALES, Ian","Hacker's handbook: a guide for 1 a$+" & O'HARA, Frank","Complete "+c$+" ROM 1 a$+" & MORTLEMAN, James","Creating adventures on your ZX 1 a$+" & JONES, Robin","Computer puzzles for the 1 a$+" & JONES, Dilwyn","Programming your ZX "+c$,iii,"6",e2,n6,"19 8",i,d 1 a$+" & GALE, H. (eds)","Times book of "+e$+" puzzles 1 a quick look at the second part, 1 `fhhffhflhf 1 ]MAGNETIC MAGAZINES 83:H\ 1 [334,"0608 4",i,d 1 ZX81 & "+c$,o,"17",e2,n3,"34543 6",i,d 1 ZX "+c$,viii,"6",e3,n9,"23 6",i,d 1 ZX "+c$,vi,"6",e3,n3,"28 7",i,d 1 ZX "+c$+" owners",iv,"7",e5,n5,"91612 7",vi,o 1 Z$="LLCC0202"+A$(N,1 1 Z$="15"+E$+"0304"+M$: 1 Z$="01010205CUSTARD PIE": 1 Z$=" YCC0202"+A$(N,Y/2 1 You'll find my entry for the 1 You soon discover that survival is not so easy. This 250 screen world is inhabited by a good variety of nasties: ants spiders, wasps, aliens and more. On the B side of the tape is a free pop single reminiscent of C4's Brookside theme. 1 You can select from four different speeds of play and twelve different levels of problem complexity. The program will also automatically move you up or down levels depending on your performance. For ages 5 to 14. FAULTLESS. 1 You can search this booklist byauthor,title or publisher, usingonly the first few letters ofeach. The longer the search key,the less chance of confusion.You may also choose from a listof broad subject headings." 1 XXXXXXX XXXX X X X XX XXXXXXXXX X X X X XXXXXXX XXXX X X X X XXXX XXXXXXX X X X X XXXXXXXXX XX X X X XXXX XXXXXXXC$ 1 X,X;"YIPPEA!!!!" 1 Worm In Paradise 1 With over 200 titles in this(hopefully) comprehensive book-list, the "+c$+" must be wortha place in the Guinness Book ofRecords as not only the best-selling "+e$+" ever, but alsothe machine with far more bookswritten about it than any other!You can now examine what is, asfar as I know, the only "+c$+"booklist currently available tothe public, and certainly theonly list in software format." 1 Where a title is available bothin hard and soft back editions,the paperback edition is listed.The majority of books in thislist are paperbacks.": 1 WRIGGLER MEMORY: 48K 16/48 RATING 1 WEAR CHINA MANS 1 W=W-(Q$(Q+1 1 W-I)+T$+M$(W+I 1 VISOR. LOOK AT SCREEN. LOOK AT 1 Use UPPER CASE for surnames -thefirst few letters may suffice. 1 UUU_UUUUUV 1 UUU_UUUUUUw 1 UUU_UUUUUU[ 1 UUU_UUUUUUV 1 UUU_UUUUUUU 1 UUU_UUUUUU> 1 UUU_UUUUUU 1 UUUUUUUUUW 1 UUUUUUUUUUUUUW 1 UUUUUUUUUUUUUU]UUUUUUUUUUUUUUUUU 1 UUUUUUUUUUUUUUUUUUUUW 1 UUUUUUUUUUUUUUUUUUUUUU_ 1 UUUUUUUUUUUUUTU 1 UUUUUUUUUUUUQUU5UTUUG 1 UUUUUUUUUUUU 1 UUUUUUUTUU 1 UUEUUUUUUTUUUUU 1 To be absolutely fair,this is the only criticism I have with regard to 1 This list does not intentionallyinclude software, but a bookwith accompanying cassette isoften hard to distinguish froma cassette with a large manual." 1 This is strictly for the Defender addict who seeksan even greater challenge. the action is fast and furious and the enemies varied, mean and lethal. Once you get intothe claustrophobic cave system survival is nigh on impossible. 1 This is not the fastest game I have played, but the animation is smooth and there is a good variety in the screen designs and the problems to be solved. Recommended for the youngat heart, but not necessarily the young. 1 The aim of the program isto help children, aged from 5 to 14 years, to develop numeric estimation skills, an often neglected, though valuable ability. (extremely useful for dealing with restaurant bills in adult life!) 1 The M/C TUTOR is 1 The LUDOIDS is 1 The Hobbit~",vi,"9",e4,n3,"161 6",i,d 1 The CROSSWORD is 1 The first few characters maysuffice. Use of a search keylonger than 32 characters is NOTrecommended. 1 THEN GO UP. WAIT.": 1 THEN CLIMB ON THE COFFIN AND 1 THE SILVER TRAY CARRIED BY THE 1 THE ENTIRE RALLY ? 1 TEE SHIRT! 1 TECHNICIAN TED MEMORY: 48K 16/48 RATING 1 TECHNICIAN TED 1 T=S+(P-I): 1 Source of reference." 1 Silicon Dream 1 SYMBOLS 1 SUBTERRANEAN STRYKER MEMORY: 48K 16/48 RATING 1 SUBTERRANEAN STRYKER 1 STOP THE TAPE^ 1 START THE TAPE 1 STAD>COL+11 1 STAD=FILE+STY*8 1 STAD,COL+1 1 STAD+FNX-STX,0 1 SLATER STREET" 1 SCROLL b$ SUBROUTINE 1 SAY TO COOK ~TELL ME ABOUT BASIL PHIPPS~"'" 1 SAM STOAT SAFEBREAKERMonty Mole may well be innocent, but this character certainly is not. Your task is to break into the four houses in Gremlin Lane and steal the contents oftheir safes. Easy? No. Moral? Not at all. 1 SAM STOAT SAFEBREAKER MEMORY: 48K 16/48 RATING 1 S=(R*P)+I: 1 S$="XXXXXXX XXXX X X X XX XXXXXXXXX X X X X XXXXXXX XXXX X X X X XXXX XXXXXXX X X X X XXXXXXXXX XX X X X XXXX XXXXXXX" 1 Roman numerals make 1 Return to Eden 1 Return To Eden 1 RRK+STAD,0 1 REVIEWS 1 RESET BIGPRINT POINTER 1 READ THIS. The other code is 1 QUIT ROUTINE 1 QNB'V THNG USAK means CAN'T 1 Q$="Guesses:"+d$: 1 Publisher, 1 Program by B.C.Thorne September 1984*K\~ 1 Please enter the search key for:": 1 PRINT WORD 1 PRINT CLUE 1 PRESS THREE OF THE BUTTONS 1 POSITION AROUND 1 PLAY TAPE" 1 PIE 1 Owners of Currah micro- speech packs also get verbal warnings and congratulations with every slave saved. Of course, most popular joystick protocols are supported and there is also the essential hall of fame. 1 Other points. 1 Other points of feedback:" 1 OPEN DRAWER 1 OIL SLICKS 1 Nffg,"11 2",v,o 1 NUMBER PAINTER 16/48 RATING 1 NUMBER PAINTER 1 NUMBER (the one you want). 1 NO``NNOOO__O__O__NNOO__OOOONNOOOOMMMNNMMMMMMMMMMMNNMMMMMMMMNNMMMOOOONNOOOOOOOOOOONNOOOOOOOONNOOOOLLLNNLLLLLLLLLLLNNLLLLLLLLNNLLLOOOONN``ONN__OOOONNOOONNOOONN__OOMMMMMMMMNNMMMMMMMMMMMNNMMMMMMMMOOOOOOOOONNOOOOOOOOOOONNOOOOOOOOOLLLLLLLLNNLLLLLLLLLLLNNLLLLLLLLOOONNOOOONNO__NNO__OOONNOOOOONNOOMMNNMMMMMMMMMNNMMMMMMMMMMMMMNNMOOONNOOOOOOOOONNOOOOOOOOOOOOONNOOLLNNLLLLLLLLLNNLLLLLLLLLLLLLNNLOOONNONNOOOO__NNOOO__ONNO__OONNNNMMMMMNNMMMMMMMMMMMMMMNNMMMMMMMNNOOOOONNOOOOOOOOOOOOOONNOOOOOOONNLLLLLNNLLLLLLLLLLLLLLNNLLLLLLLNNOOOOONNOOOONNOOOOOOOONNONN__OONNMMMMMMMMMMMNNMMMMMMMMMMMNNMMMMMMGGOOOOOOOOONNOOOOOOOOOOONNOOO 1 NIGHTINGALE GO NORTH AND 1 Microdrive",iv,"5",e4,n4,"12406 7",i,d 1 Microdrive and Interfaces",iv,"10",e4,n5,"28662 5",ii,81284 1 Major Ffoulkes 1 Magnetic Magazines Ltd.*6\$: 1 MULTS(X) A 1 MAGNETIC MAGAZINES : 1 M$=T$+M$(2 1 London W4 4PH. 1 Last name only of publisher isused. 1 LWH Volume 2 1 LUDOIDS C5?). THE SIX DIGITS ARETHE LOCATION OF THE CREWMEMBER. THE 1ST DIGIT IS THE FREEZER 1 LUDOIDS #4 1 LOOK THROUGH HIDDEN DOOR"'"What he saw gave him a clue to the method of entry." 1 LIVE WIRE 1 LINE PRINT ROUTINE 1 LIBRARY GO NORTH TO THE ARCHIVE,TAKE MEMPACK, INSERT IT, LOOK 1 LETTER 1 LD HL,4001h 33,1,64" 1 LD BC,64510 1,254,251" 1 L$=" ": 1 Kim Kimberly, is a woman. 1 Kim Kimberley, secret agent 1 K$(F,NN)="*": 1 J$="--------------------": 1 It's probably due to the cold 1 Issue 17 Competition 1 Int Std Bk No, 1 In the game you must steer your car into the lane which has the answerclosest to the correct result of a mathematical expression displayed at the bottom of the screen In this race against the clock you must avoid oil slicks and rocks and yet 1 In 10 (very broad) categories: 1 If you wish to list the entirefile from a chosen initial, typethat initial, followed by 1 If you stop or break the program~ 1 If you like this sort of game (and who doesn't?) Ihighly recommend it as the best I have seen. It is a real challenge tothe keen hacker. Even with the useful REM in the loader program I had quite a job just getting this picture. 1 If you do find the new generation of arcade adventures too demanding on the brain then this could be for you. The only things that I can criticize are the high level of flicker on your fighter's sprite and somejagged screen scrolling. 1 INPUT WORD 1 INPUT SOLUTION 1 IN;" PRESS ANY KEY FOR FRONT VIEW. ": 1 IIIIIIIIIIIIIIIIIIII 1 IIIIIIIIII 1 I$="))))))))))))))))))))": 1 Hardcopy is available via yourZX or Alphacom printer." 1 Guides). (For children)",v,"5",e4,n2,"12259 5",i,d 1 Greetings again!"''"Another ~pretty missive~ with more suggestions and comments!" 1 Good game designs will never die! This is one ofthose Defender-through-a-cave-system type games. Simply blast your way through the five levels of this alien complex andsave the slave workers onyour way. 1 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 1 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGD8888 1 GGGGGGGGGGGGGGGD888888888888888D 1 GGGGGGGGGGGGGG 1 GGGGGGGFCCCCCCC 1 GGGGGGFFGGGGGGGGFFFFFFFFGGGGGG 1 GGGGGFFFFCC 1 GGBBBFFFFFC 1 GGBBBFFFFCC 1 GFFFFFGGGGGGGG 1 GDDLLLLLLLLLNNLLLLLLLLLLLNNLLL 1 GBBFBFFFFFF 1 G ""BOOKLIST""*" 1 Firstly; What happened to the cassette inlay card?"'"Ever since 1 FREEZER DISK. THE REST IS EASY.": 1 FREEZER DISC 1 FNY1=FNY-1 1 FNY1=FNY+1 1 FNX-STX=-2 1 FNAD=FILE+FNY*8 1 FIGCHESS 1 FIG CODE 1 FGGGGGGGEEEEEEE 1 FFFFFGGGGCGGG 1 FFFFFGCCGGGG 1 FFFFFFGGGGGGGG 1 FFFFFFFFGFGGGGGGFFFFF 1 FFFFFFFFFFFFFBBBBBBFFFFF 1 FFFFFFFFBBBGGGGG 1 FFFFFFFFBBBBB 1 FFFFCCFCBBGGGGGGCCGGCFFFGGGGGG 1 FFCFFFFFGGGGGGGGFFCC 1 FFCFFFFFGGGGGGGG 1 F ""CROSSWORD"" 1 Entries traced in BBIP before 1 Enter the number of your choice,or 1 Easy programming: ZX "+c$+". 1 Each house has a diferent level of difficulty and its own twenty rooms. To open a safe you will need to find a bomb, a match and of course,the safe. Beinga high risk area for burglaries, each house iswell supplied with a 1 ESTIMATOR RACER 16/48 RATING 1 ESTIMATOR RACER 1 EEUUUUEUEEUETE 1 E ""comp17"" 1 DOOR POSTSy 1 DIVISION ( 1 DISC COLOUR. THE SECOND IS 1 DGGOOOOOO__ONNO__OOOOOOOONNOOO 1 DDDDDDDDDDDDDDDDDDDDD 1 DATA - see line 370 1 DARK STAR COMPETITION 1 D1=STY-FNY: 1 D ""BULLETIN"" 1 Congratulations ! 1 Chiswick, London W4 4PH. 1 CUSTARD 1 CURSOR UP & DOWN, 0 TO mOVE ON. (R to run code Q to stop code.) 1 CROSSWORD . 1 CONFUSED BAT RACE MAKES A FLOOR SHOWK 1 COFFIN. TO AVOID THE 1 CLEAR ROADS 1 CHECK FOR FINISH 1 CHEAT SUBROUTINE 1 CCCCCCCCGGG 1 CABARET 1 1 6 00KID 1 9 2 00ADVOCAAT 3 4 7 00BEAGLE 5 1 5 00TSAR 5 8 3 00SIGN 7 1 3 00PENCIL 7 6 5 00BARNACLE 9 1 7 00EGO 111 2 00BUTCHER 115 6 00CARIB 1 1 4 10RIDDLE 1 5 5 10THOR 1 7 3 10KNAPSACK 1 9 7 10DETER 1 114 10KANGAROO 4 3 7 10PELLET 6 7 5 10SABRE 7 1 4 10LINER 7 114 10JAMB 8 5 3 10W 1 C$=C$+" ? ": 1 C$="WAIT FOR A WHILE": 1 C$="SPECIAL" 1 C$="QUIT GAME": 1 C$="INVENTORY": 1 C$="HELP": 1 C$="GO WEST": 1 C$="GO UP ": 1 C$="GO SOUTH": 1 C$="GO NORTH": 1 C$="GO EAST": 1 C$="GO DOWN": 1 C ""REVIEWS"" 1 Bkslr = Bookseller (weekly). 1 BUTTLER IN THE HABIDROME. WAVE 1 BULLETIN u 1 BUBBLE BUS COMPEITION, 1 BUBBLE BUS 1 BOOKLIST Pt 1 BLINK. Had me fooled as well.": 1 BBGGGGGFBBBBBBB 1 BBBBGGGCGG 1 BBBBBBBBBBB 1 BASIC",ii,"8",e4,n7,"022677 6",i,d 1 BASIC"+" & machine code 1 B<<dDd$fB~<B 1 B< P\B]]B< 1 B///////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////-///////////////////////////////-////////((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((,,,((((((,,,,,,(,((((((((((((,,,++***(++++++++*********(+(++++++ 1 B$=B$+" 1 B$="You can only take the detector with you.": 1 B$="Do you want toSAVE this program ?": 1 B ""FIGCHESS""* 1 As bibliographical details canvary widely between sources, itis wise to check with publisher/bookshop before ordering." 1 As Ted, you must travel around 50 rooms of the factory and complete 21 tasks, most of which havea time limit and all of which must be completed before home time -5.00pm-or you get the sack. Yourmain problem is finding out which tasks to do. 1 Arrowhead Software 1 And now! With the press of a 1 Advert = Publisher's or book- 1 AT VIEWER. THE VIEWER HAS 1 AS WELL AS YOUR NECKLACE.": 1 ARRAY AND NT E E R UT A LOGICALRED L U LI COMMA SBIN W E BITU E IN E RT X T E IEXTEND OPEN O O E GOR RETURN 1 ANOTHER USE (REMEMBER THE 1 AND THE 3RD IS THE LEVEL IN 1 ADDS(+) AND SUBS(-) ? 1 A$="some M/C in this letter": 1 A$="TODAY'S": 1 A$="POKE 23607,60 . ": 1 A$="Keep up the good work with the": 1 A$="IS 1016 BYTES LONG STARTING AT": 1 A$="IN THIS LETTER IS FROM 31510 -": 1 A$="CHARACTERS,POKE 23606,0 AND": 1 A$="BINO": 1 A$="31534. RUN BY RAND USR 31510.": 1 A$="2. THE ALTERNATE CHARSET USED": 1 A$=" compliment you on the": 1 A$=" Dear 1 A$=" Q TO QUIT R TO READ AGAIN": 1 A$=" T.JANE": 1 A ""16/48D&G17"" 1 >fff,"03 2",i,d 1 >MMMMyyyMMMMMMMMMMMMMMMMMMyyyMMMMOOOOyyyOMMMMMMMMOOMMMMMMOyyyOONNLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL 1 <fxx||xfxx| 1 ;y,i$,"[";b$(b);("0" 1 ;A$(F);" To Move () ": 1 ;;;;;;;;;;;;;;;;888;;;;;;;;;;;;;;;;;;;;;;;;;;;;8888;;;;;;;;;;;;;;;;;;;;;;;;;;;888888;;;;;;;;;;;;8;;;;;;:8888888888888888888::::88888888888888888888888888::::::8:::::::8:888888888888888:::::::::::::::88888888888888888888888::88888888xxxxxxxxxxxxxxxxx888888888888888x```````````````x888888888888888x```````````````x888888888888888x```````````````xx88888888888888x``````````````xx888888888888888xxxxxxxxxxxxxxxxx8888888888888888888xxxxxxxxxxxx88888888888888888888xxxxxxxxxxx888888888888888888888xxxxxxxxxx8888888888888888888888xxxxxxxxx88888888888888888888888xxxxxxxxx88888888888888888888888xxxxxxxxx88888888888888888888888xxxxxxxxx88888888888888888888888xxxxxxxxx88888888888888888888888xxxxxxxxx888888888888888888888888888888x88888888888888888888888888888898888888888888k 1 ;"wrote pyramania and"; 1 ;"to the crosswords?" 1 ;"provided this assistance."''"BREAK out before the 1 ;"press Y to play again, N to quit" 1 ;"own programs?" 1 ;"direct command."'"FOR n=1 1 ;"competition in issue 13?" 1 ;"cheat line as a"; 1 ;"and enter the following"; 1 ;"YOU COLLECTED ALL 25 DIODES FROM THE TWO CIRCUITS! "; 1 ;"Who won the DARKSTAR"; 1 ;"What does make 1 ;"WHO'S MOVE BLACK (2)or WHITE (1)"'F: 1 ;"WHAT IS THE NAME OF THE FILE."'N$: 1 ;"WHAT DO YOU WANT TO NAME IT."'N$: 1 ;"WEAR IT. IT'S A SPACE SUIT. THETRINKETS ARE HANDY TO.": 1 ;"Two quick points for new readers(or reminders for old ones)."''"To save programs to microdrive you can BREAK and GOTO 9998."''"To save programs to tape you canBREAK and GOTO 9999."''"We try to make this work on as many of our programs as we can."'"(This month it works on all the programs except the adventure which has its own save option and the reviews.)" 1 ;"To use LET x= 1 ;"This program contains our usual bigprint routine (in line 0) anda short 64 byte routine at "; 1 ;"The following..."; 1 ;"The adventure starts with you 1 ;"That's all for now"''" 1 ;"THE USUAL SOLUTION HERE. USE 1 ;"THE CAN IS PRESSURISED, SO KEEP IT IN THE TOOL BOX. A WEAPON?": 1 ;"TAKE THE VIEWER FROM THE 1 ;"Sorry this program has been"'"copied once already": 1 ;"Snowball is a text only 1 ;"Send letters, programs or ideas to"'" 1 ;"STOP THE TAPE"; 1 ;"STOP THE TAPE": 1 ;"SIT IN THE CHAIR WEAR THE 1 ;"SCORE:";SC;" LIVES:";L 1 ;"SAVE ""script"" 1 ;"RUN THE TAPE": 1 ;"Press any key to continue": 1 ;"Press any combination of keys 1 to 5 and see what effect they have on the value returned to the 5 least significant bits of the input port." 1 ;"Press a key": 1 ;"Press a key to Trans-mat down": 1 ;"PYRAMANIA from issue 12?" 1 ;"PULL THE LEVER AND GET OUT OF 1 ;"PRESS ANY KEY" 1 ;"PRESS ANY KEY TO CONTINUE": 1 ;"PRESS ANY KEY TO 1 ;"PRESS A KEY": 1 ;"PLASTIC SAFETY-ZONE: "; 1 ;"P.Lant to"; 1 ;"No mistake, I do mean 1 ;"Nicholas Murray"; 1 ;"Liz Townley in Stroud,"; 1 ;"LUDOIDS #4": 1 ;"LUDOIDS #4" 1 ;"LIVE WIRE"; 1 ;"LIVE WIRE": 1 ;"LIVE WIRE" 1 ;"LETTER": 1 ;"LEAVE TAPE RUNNING": 1 ;"KEYS: Q: UP Z: DOWNP: RIGHT I: LEFT" 1 ;"J7JNJdJ|J 1 ;"In these adventures you play 1 ;"If Holmes can be inside the 1 ;"Ian Davies of Birkenhead,"'"Mr J M Maybury from Walsall,"'"Sue Spence from Northampton,"'"Philip Markin in Nottinham and"'"Mr A S Miller from London NW8." 1 ;"INSTRUCTIONS"; 1 ;"ILLEGAL": 1 ;"How can I use the"; 1 ;"How can I get the solution"; 1 ;"HOW can I ever finish"; 1 ;"HOLMES HINTS"''" 1 ;"HOLMES HINTS!"''" 1 ;"HIT A KEY( 1 ;"GO TO ROBOT CENTRAL STORES. YOUNEED THE RED AND ORANGE CARDS 1 ;"FIGCHESS" 1 ;"Everyone wants to know where 1 ;"DIODE: "; 1 ;"CUSTARD" 1 ;"CROSSWORD" 1 ;"CIRCUIT TWO": 1 ;"BY GRAHAM ADAIR" 1 ;"BULLETIN" 1 ;"BREAK into the program,"; 1 ;"BREAK from this program,"; 1 ;"BOOKLIST": 1 ;"BOOKLIST" 1 ;"As with all Level 9 adventures 1 ;"ARE YOU SURE YOU WANT TO QUIT? PRESS Y FOR YES OR N FOR NO." 1 ;"16/48TITLE": 1 ;"16/48 script in my "; 1 ;"16/48 Magazine": 1 ;"""tutor8"""'''"We continue our machine code tutor series with a look at how to read the keyboard and make appropriate decisions.": 1 ;"""micro"",""mail"""'''"Two letters this month. This oneis from Terrence Jane in Dorset.": 1 ;"""letter"""'''"Another very pretty missive fromP Lant. This one is full of SHERLOCK graphics and hints which make it a 48K program.": 1 ;"""edit"""'''"DARK STAR competition winners, the infinite lives pokes we all need to finish ""pyramania"" and details on how to cheat at the crossword."''"Plus the minimum of blurb from the font of all thingies.": 1 ;"""comp17"""'''"The BUBBLE BUS, Wizard's Lair competition. 10 copies of their latest hit game and TEN TEE SHIRTS to be won."''"All you have to do is unscramblethe loading screen from WIZARD'SLAIR and send us the proof on tape.": 1 ;"""REVIEWS"""''"Comments and screen displays from the latest software.": 1 ;"""LUDOIDS #4"""''"Chapter 4 of our new adventure with full screen graphics and fast response to instructions inordinary English.": 1 ;"""LIVE WIRE"""''"A really good example of a 16K BASIC game which, because it is based on a good idea, is much more enjoyable than many less well thought out machine code juggernauts."''"An example to us all from GrahamAdair in Edinburgh.": 1 ;"""FIGCHESS"""'''"Rob and Trevor Figgins have donethe prettiest three dimensional simulation of a chessboard ever seen on the Spectrum. Remember ""Chessfire"" in issue 1?!": 1 ;"""CUSTARD"""'''"An irresistable variation on hangman from Michael Silve.": 1 ;"""CROSSWORD"""'''"This month our first symmetricalpuzzle. Sent in by crossword compiling wizard -J Madden."''"(You too could win a portrait in brown of the lady of the lamp if you send in a good 11 by 11 crossword with solution and clues on paper!)": 1 ;"""BULLETIN"""''"We have had regular requests fora program which enabled bigprintand our scroll routines to be used together. Well here it is.": 1 ;"""BOOKLIST"""'''"An improved,expanded and updated48K data base on all Spectrum related books from Berwickshire librarian, John Luby.": 1 ;"""16/48D&G14"""''" ""OF DUNGEONS AND GREEN MEN"""''"More adventure help from YAZ.": 1 ;" You must guide THE 1 ;" YOUR NAME GOES DOWN IN HISTORY!" 1 ;" When you've collected all the Diodes in the first circuit, yougo onto a second one, but the powersurges come a little faster(just to keep you on your toes!)" 1 ;" To avoid being electrocuted youmust make sure that you are in aplastic safety-zone whenever thecurrent flows. If you get caughtout, BZZZZZZZZZZT!!" 1 ;" TAPE 17 MAY 85 SIDE 1 " 1 ;" After a while you'll get the hang of anticipating the power- -surge." 1 ;" 16/48 MAY 85 TAPE 17 " 1 ;" * FULL 48K PROGRAMS."'" (16K MACHINES WILL SKIP THESE.)": 1 ;" Select (R,N,B or Q)" 1 ;" PRESS ANY KEY TO 1 ;" PRESS ANY KEY TO CONTINUE " 1 ;" MENU "; 1 ;" ": 1 ;" ": 1 ;" ": 1 ;" " 1 ;" ": 1 ;" ": 1 8<8888888888888 1 8(88(88(hXp 1 7962"+" bytes remaining.": 1 666666666666666666666666666666666222222222222'''''''''222''''''66222222222222'''''''''222''''''66'''''''''''''''''''''222''''''66'''''''''''''''''''''222''''''66222222222222222222222222''''''66222222222222222222222222''''''66''''''''''''''''''''''''''''''66''''''''''''''''''''''''''''''66''''''''''''''''''''''''''''''66''''''''''''''''''''''''''''''662222222 2222222222'''''''''662222222 2222222222'''''''''66''''''''''''''''''222'''''''''66''''''''''''''''''222'''''''''66222222222'''''''''222'''''''''66222222222'''''''''222'''''''''666666666666666666666666666676666 1 63486"'"1470 LET x=x-32* 1 48k",ix,"7Phoenix946576",e4,n5,"10 6",i,d 1 44444444444444444444444444444444444444444444444444444444444444444444444444444440000000000000000 1 333333333` 1 33333333333333` 1 23636+34": 1 22:GOSUB 9100:NEXT n"''"This month's program has the cheat line written in and even has a REM line highlighted in the listing. Never say we aren'thelpful." 1 222211111111!!!!!!!!! 1 2000 000 hibernating colonists?": 1 2 vols)",v,"7Educare907907",e2,11.9 1 16/48TITLE 1 16/48LOAD2 1 16/48LOAD1 1 16/48D&G17 1 16/48 magazine, 1 16/48 Magazine, 1 1111111111111111111111111111111111111111111111111111111111111111111 1 100 1 10 barley Mow Passage, 1 10 Barley Mow Passage, 1 033333333` 1 ."''"n is a number between 0 and 7"'"r is register A,B,C,D,E,H or L." 1 . (Be my guest. Ed.)": 1 ,o;"-------------------------"; 1 ,c;" =rstuvw" 1 ,c;" KLLM " 1 ,XPR;Z$;")": 1 ,O;"PRESS ANY KEY TO BEGIN..": 1 ,O;" "; 1 ,F;" 23": 1 ,F;" 23 ": 1 ,#;9;O;e;|; 1 ,"99 5",i,d 1 ,"8 9",i,8.84 1 ,"70 8",v,o 1 ,"692366 6",i,d 1 ,"692240 6",i,d 1 ,"636610 4",i,d 1 ,"30 0",ii,221284 1 ,"29 1",i,d 1 ,"28 5",i,d 1 ,"27 5",i,d 1 ,"25 1",i,d 1 ,"22633 3",i,d 1 ,"1623 3",i,d 1 ,"13 9",i,8.84 1 ,"099 6",i,d 1 ,"097 4",i,d 1 ,"0351 4",i,d 1 ,"02075 7",i,d 1 ,"01235 7",i,d 1 ,"001698 4",vi,o 1 , but more about that 1 , a few months 1 +hp-viii*yp: 1 +(i$="R")*2 1 +(i$="Q")*8 1 +(i$="N")*4 1 +(i$="B")*6 1 **************** 1 *************** 1 *((((((((((((((((((((((((((((((((//////////////////////////////*/-------------------------------- 1 *"m";m;m$: 1 )="WHITE " 1 )="BLACK ": 1 );"hours "; 1 )+,-.012"; 1 )+". TO RETURN TO NORMAL ": 1 ));"Minutes."'"PRESS ANY KEY ( 1 )))))))))))))))))))))))))"; 1 (x/256)-1."'"(POKE 23606,0:POKE 23607,60 to return to normal.)" 1 (x/256)"'"POKE 23607, 1 (sty-fny)=0 1 (stx-fnx)=0 1 (prog+1217 1 (p*x)<.001 1 (With audio tape)",iii,"6",e3,n4,"22 8",i,d 1 (This is the easiest way to get both disguises)" 1 (STY-FNY): 1 (RRK+STAD): 1 (Listed BBIP as by ~CARTE~)",v,"1",e4,n7,"0606 8",i,d 1 (Interesting)" 1 (In the Browns' STUDY)" 1 (FNX1+FNY1* 1 (FEFEh) CAPS/SHIFT to V"'" 1 (FDFEh) A 1 (FBFEh) Q fo T"'" 1 (EFFEh) 0 to 6"'" 1 (DFFEh) P to Y"'" 1 (BFFEh) ENTER to H"'" 1 (7FFEh) SPACE to B" 1 (2nd ed)",iii,"5Shiva85014",e4,n5,"046 4",iv,o 1 (((B((((((==88888888888888888888(((((((((((=88888888888888888888hhhhhhhhhhhh88888888888888888888XXXXPPPPPPX888888888888888888888XXXXPPPPPPX888888888888888888888xPPXPPPPPPXxxxxxxxxxxxxxxxxxxxxxxPPXPPPPPPXxxxxxxxxxxxxxxxxxxxxxpPPXPPPPPPXpppppppppppppppppppppprPXPPPPPPXppppppppppppppppppppppprXXXXXXXXpppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppprrrrpppppppppppppppppppppppppppprrrrpppppppppppppppppppppppppppprrrrpppppppppppppppppppppppppppprrrrpppppppppppppppppppppppppppppppppppppppppBBBBBBBBBBBB 1 's, epic space travel, 1 '''''"This instruction tests bit 1 '''"This time we look at how to readthe keyboard fom within machine code programs." 1 '''"This program can be used just asit is or you can take a closer look at the subroutines at lines1013 and 4000 to work out how tochange the magnification factorsof the bigprint routines." 1 '''"This is a little routine to do odd things with the upper screenuntil you push Q." 1 '''"These 4 lines are now runnng"''"1460 LET x= 1 '''"The outer keys (1,0,Q,P etc.) affect BIT 0, the inner keys (5,6,T,Y etc.) affect BIT 4." 1 '''"See you next month."''"Press any key to start again."''''" 1 '''"If you want to test for a combination of keys then the masking operation can be done with" 1 '''"At this stage we need to bring in a new instruction.": 1 ''"When BIGPRINT has been updated to remove the BASIC content we may be able to improve on this program." 1 ''"We can demonstrate the effect ofone group of five keys with a short BASIC routine." 1 ''"We also show how to avoid the problems which can arise from ignoring the subtle differences between issue 3 Spectrums and earlier models." 1 ''"These are the port addresses we need to read the keyboard." 1 ''"The jerky movement is a result of the need to stop the scroll while each character is printed." 1 ''"The Z80 has several instructionsfor reading input ports, but if we ignore the block inputs and the instructions which include incrementing or decrementing we are left with two." 1 ''"Press any key for another demo." 1 ''"If you look at page 160 of the manual you will find these addresses. (Page 60 of the Spectrum+ User Guide has the same but with less detail.)" 1 ''"Enter the co-ordinate of the piece to be moved (Letter first then number.),then enter the co-ordinate of the place it is to be moved to." 1 ''"Bits 5,6 & 7 are affected by theEAR socket, the issue number of your Spectrum and cosmic rays. It is important to mask them offif they could affect your program." 1 ''" 1 ""LIVE WIRE"" 1 '"{C} To Save game {L} To Load old game {R} To Reverse Board "'"{Q} To Quit "'"{S} To Restart Game "'"{I} For Instructions "'"{P} To Continue game " 1 '"This removes irrelevant bits." 1 '"This program can be used just as it is to display any message of almost any length with bannertitles above and below" 1 '"There are exits visible;"'("North," 1 '"If the bit is zero the ZERO flagis set. If not, it is reset." 1 %,:,P,e,{, 1 #p;"H = HELP"'"P = PAUSE"'"R repeats the previous command"'"Q = QUIT" 1 #p''"You will need to draw a map of where you go to avoid getting lost.": 1 #p''"Once the jammer has been"'"destroyed, you can return to"'"your spaceship by pressing the wrist detector." 1 #p'"Your mission is to find the"'"LUDOIDS |, and destroy their"'"Trans-Mat jammers" 1 #p'"You have a WRIST DETECTOR which will destroy a jammer if you"'"press it when you are near one." 1 #p'"The following letters"'"ON THEIR OWN have special"'"meanings" 1 #p'"The Computer will tell you what happens. You tell the computer what you want to do by typing inENGLISH and then pressing 1 #p'"N = Go NORTH"'"S = GO SOUTH ...etc"''"V or L Shows the VIEW"'"I = INVENTORY (""What have I got with me ?"")" 1 #p'"LOAD- allows you to load the"'"details back again." 1 #p'"Avoid negatives or trying to do more than one thing at a time." 1 #P''"SAVE- will save details of the game at any point to tape, in two short pieces of code" 1 #P''"Hi-res full screen pictures willremain displayed until you pressany key." 1 #P'"Be specific in your instructions(""TAKE THE KEY"" will be"'"understood"'"""TAKE"" will not)" 1 "zzzzzz...": 1 "prog+361": 1 "name? ";m$'"Drive ? ";m: 1 "code*100": 1 "all","general","business","programs","programming","hardware","children/educn","games","graphics/sound","machine code","science/maths": 1 "a"'"which scrolls one third of the screen to the left one pixel at a time." 1 "ZINCNEWTDIRTFADEFLAGGAINFAKEGOWNSTAYHATEDUSTMASKPLUGCOMBSHOEFOOTHAIRHEATTRIMWALLBEANFINDLEADBIKEROCKTHISOVERDOWNCOOLYOKEDOCKROCKBOOKEXITLOCKOPENTARTTREEWALLHEADPEARPLUMLAMPLIONHANDNECKNOSEREADBATHSOAPFIVESHOEWOODDOWNLEFTSHOPFOURFIVENINEBLUESOCKTAPESOUPCOLDLEAFGRIPLIONQUITKEPTUTAHCORKWIREBARKGULFGREYYARDVASTBUSHHIDEJUSTRACEKNOTTURNCASTOVERSAMEPASTFOLKCASTVASEVOTEDRIPWIPEKITEHARPEXITZEST" 1 "You take the ";m$: 1 "You see nothing more to help you": 1 "You see a chest in the sand.": 1 "You need to get into the game more!": 1 "You made it !": 1 "You kill the SCORPION": 1 "You have with you;": 1 "You have nothing to feed them"'"with.": 1 "You have nothing to eat": 1 "You have nothing to drink": 1 "You have not found the"'"co-odinates yet !": 1 "You have not destroyed the "'"jammer yet": 1 "You get into the chest, you are able to paddle it": 1 "You find an island of banana"'"trees": 1 "You fall off the edge of the"'"planet.": 1 "You drown in a whirlpool": 1 "You drop the ";m$: 1 "You don't find anything": 1 "You do not have the correct key": 1 "You cannot" 1 "You cannot go in that direction": 1 "You can see; ";m$ 1 "You are still on the shore of"'"the large lagoon": 1 "You are still on the shore line.": 1 "You are on the shore of a large lagoon": 1 "You are on an island with bananatrees on": 1 "You are not strong enough": 1 "You are in the cave with a ";("dead " 1 "You are in the Lagoon.": 1 "You are ignored": 1 "You are getting the scorpion"'"very annoyed.": 1 "You are eaten alive by piranha.": 1 "YELLOWCHURCHSOCKETSCHOOLFATHERMOTHERUMPIRESPRIALLEGACYFINISHKETTLEFALCONDEGREESPONGESNEEZENATURENAPKINMELODYMEMORYZODIACWEEVILPLAGUELITMUSWREATHCHINTZGROTTODRAGONZENITHRECORDACROSSAROUNDANIMALBURROWBRANCHWEAPONBRIDGECAUGHTVISIONMUTINYBOTTLEORANGEMIRRORJACKETCARPETFOLDERPILLOWBANANAPEANUTSPIDERFRIDGEZIPPERROTTENSECONDHOLLOWDEVISESQUEALVOYAGEDEVOIDTICKETVIOLETJUMPER" 1 "What are you going to do ?"'" 1 "WREN-HILTON, Martin","Games to play on your ZX 1 "WORD?";W$: 1 "WOOLLEY, Ben & BIDMEAD, C.H.","Micro enquirer: "+c$,o,"1",e4,n8,"0409 X",i,d 1 "WOOD, Tony","Learn & use assembly language onthe ZX "+c$,viii,"8",e3,n6,"084705 3",i,d 1 "WILSON, John","Cracking the code on the 1 "WILLIAMS, Philip (ed)","Over the "+c$,o,"9",e3,n6,"109 8",i,d 1 "WILLIAMS, Noel","Invent and write games programs for the ZX "+c$,vi,"8",e3,n6,"084719 3",i,d 1 "WHEELWRIGHT, Geoff","ZX "+c$,o,"7",e4,n4,"91608 9",ii,110884 1 "WEST INDIAN NATIVE","LARGE SEIVE OR SMALL PROBLEM","A BADLY SPELLED MELTING OR A THUNDEROUS DEITY","SOLDIER'S PACK","DISCOURAGE","ANTIPODEAN MARSUPIAL","A SMALL ROUND PART OF LAPEL LETTERING","VARIETY OF WULF?","CRUISE SHIP","DOOR POST" 1 "WEBB, Steve","Practical "+c$+" machine code programming",viii,"6Virgin86369",e4,n3,"045 9",i,d 1 "WEBB, David","Advanced "+c$+" machine 1 "WARDLE, Michael & MILLS, John","ZX "+c$+". (Young programmer'sguide)",iii,"17",e5,n4,"38368 0",iv,o 1 "WALSH, James",c$+" machine code made easy.Vol 1. (See also: HOLMES, Paul)",viii,"6",e3,n5,"43 0",i,d 1 "WAITE, Mitchell & CHAPNICK, P","Timex/"+d$+" BASIC"+" primer withgraphics",iii,"8Sams(US)672",e4,n8,"22077 6",i,d 1 "VICKERS, Stephen",d$+" "+c$+": pocket 1 "VALENTINE, Roger",c$+" business book",i,"3V&H946008",e4,n9,"08 6",i,d 1 "Unable to follow him through the 1 "Tread carefully this has the"'"stamp of a Ludoid trap.": 1 "Time passes...": 1 "This SAVEs this stage of the"'"game on to tape."'"Do you want to carry on ? Y/N": 1 "This LOADS a previous game from tape"'"Do you want to continue ? Y/N" 1 "They have a ludoid symbol (|) onthem, 1 "There is something buried in thesand": 1 "There is no reply": 1 "There is a cave entrance to the South. You see some CYCLAPES ": 1 "The scorpion stings your ankle. You are killed": 1 "The scorpion is slowly advancingtowards you": 1 "The lagoon is to the north": 1 "The key does not fit": 1 "The cyclapes rush to the bananas.": 1 "The Cyclapes block your way": 1 "The Cyclapes are hungry."'"One of them has a pair of"'"binoculars !": 1 "TOMS, Trevor R","ZX "+c$+" pocket book",o,"0Phipps Ass9507302",e2,6.5 1 "THOMASSON, Don","Advanced "+c$+" Forth",iii,"9",e4,n8,"142 X",i,d 1 "TANG, William (ed)",c$+" machine language for 1 "TAKOUSHI, Tony","Best software guide: "+c$+" 1 "Sources checked to Dec 1984, ascarefully as possible, but usualdisclaimers." 1 "Sorry, I didn't understand."'"Try again.": 1 "STREET, C.A.","Information handling for the ZX "+c$,i,"8",e3,n6,"084707 X",i,d 1 "STEWART, Ian","Gateway to computing: ZX 1 "STANLEY, Paul","25 programs for the "+d$+" ZX Microdrive: multi-user games forthe "+c$,ii,"10",e4,n5,"28674 9",i,d 1 "SPEEL, S. Robert","Better programming for your 1 "SPECTRUM...",c$+" Microdrive handbook",iv,"1",e3,n4,"0206 2",i,d 1 "SPARROWHAWK, Anne","Getting the most from your 1 "SPARKES, R.A.","ZX "+c$+" in science teaching",v,"9Hutch'son9",e4,n8,"158201 6",i,d 1 "SOLOMON, Meyer","My ZX "+c$+" and me",o,"3",e4,n2,"1844 X",i,d 1 "SMIT, Rudolf",c$+" software projects",ii,"9",e4,n6,"150 0",i,d 1 "SINCLAIR, Ian R","Introducing "+c$+" machine 1 "SINCLAIR USER",d$+" User book of games and programs for the "+c$,ii,"20",e4,n3,"007815 0",i,d 1 "SIMPSON, R.J. & TERRELL, T.J.","ZX "+c$+" user's handbook",o,"6Newnes408",e3,n6,"01323 0",i,d 1 "SIMISTER, W","How to write ZX "+c$+" games 1 "SHAW, Peter","Games for your ZX "+c$,vi,"13",e3,n2,"84 7",iv,o 1 "SELF","YOU CAN GET MEAT FROM THIS CUT HERB MIXTURE" 1 "SCOTT, Allan","Complete "+c$,o,"5",e4,n9,"12569 1",i,d 1 "SCALES, Ian",c$+" peripherals guide",iv,"10",e4,n4,"28459 2",i,d 1 "Rewind Tape & play to 1 "RUGAXEWINTOPACTENDICEDRYTEACATDOGBATHATCARFARSATMATRATOUTANDBYEENDBOXPENCUPBEDEYEZOOLEGBAGPOTYOUWASBUSONETWOSIXTENREDTRYPIPJAMTOERIPBIGSOWPIGHOTLIDSAYBEEANTDIGEARWIGZIPKEGPITDAYUSENOWFEWBUTHASSKYPINSEAKEYBARFORDIPWETRUNSUN" 1 "ROSS-LANGLEY, Richard",c$+" machine code reference guide: Microdrive, Interface 1 &ROM disassembly",viii,"6",e4,n4,"51 1",i,d 1 "REWIND TAPE & PLAY": 1 "REVIEWS." 1 "RENKO, Hal & EDWARDS, Sam","Spectacular games for your ZX 1 "RAMSHAW, Mark","Discover your ZX "+c$,o,"1",e4,n2,"0424 3",i,d 1 "Put empty cartridge in drive 1"'" 1 "PUT DOWN YOUR JOHN HANCOCK","WRITING INSTRUMENT","SMALL CLINGING CRUSTACEAN" 1 "PRIGMORE, Clive","30 hour BASIC"+": ZX "+c$+" ed",iii,"19",e3,n6,"394 6",i,d 1 "PLAY THE TAPE": 1 "PERSONAL COMPUTER WORLD","Best Personal Computer World 1 "PERRY, David","Astounding arcade games for your"+c$+"+ and "+c$,vi,"6",e4,1.25 1 "PENNELL, Andrew","Master your ZX Microdrive",iv,"12",e3,n6,"19 X",i,d 1 "PEACEY, Nick & OLIVIER, Bill","Nick and Bill's "+c$+" guide",o,"19",e4,n4,"399 7",iv,o 1 "OMNIBUSPLATOONGRUMMETPALETTELIQUEURPLATEAUTANKARDTRIUMPHWEATHERZEALOUSEXHAUSTEXHIBITMENTIONMELANINNAUGHTYOBVIOUSOBELISKOBSERVESPONSORELEMENTEMBARGOFICTIONHAULAGEHORIZONMAGENTAORCHARDORGANICPARSNIPPENGUINPERFUMEABILITYADDRESSALCOHOLANAGRAMCLIMATEADAPTOREXAMPLEJEALOUSJUGULARKETCHUPKINGDOMKNUCKLELACQUERCUSHIONBROTHERECONOMYBISCUITSHAMPOOVINEGARPARADOXGRIZZLEANXIOUSPASSAGETRAFFIC" 1 "OMEGAALPHANICHEDIRTYFIELDFIBREFETCHHABITGYSPYHAZELGRAPHBRUSHPLACESHIRTPOUNDCHAINPLANESPORTRADIORANGEFIRSTWORLDCOUNTMOUSEHOUSENIGHTCHILDNURSEINDEXFLASHMELONRHINOCLOCKAPPLEVIDEOPAPERGLASSFLOORFRUITTIGERZEBRATOOTHWATERUNDERCLOSERIGHTBARGETHREESEVENEIGHTGREENBLACKWHITEBLITZFIGHTLIGHTCHAIRGRASSBREADTOASTCHICKKNIFEQUICKCARRYCAMELUNCLESUPERDOUGH" 1 "NUMBER OF WORDS?";W 1 "NICHOLLS, Stuart","Assembly language for arcade 1 "NELSON, Andrew","Games of action and excitement 1 "NAYLOR, Jeff & ROGERS, Diane","Inside your "+c$+": a guide tothe anatomy of the hardware",iv,"12",e4,n6,"35 1",i,d 1 "McLEAN, Ian & others","ZX "+c$+": your personal 1 "McLEAN, Ian & GORDON, John","100 programs for the ZX 1 "McBRIDE, P.K.","Games for your ZX "+c$,vi,"7",e4,n3,s$,iv,o 1 "Make sure that your map is"'"accurate": 1 "MURRAY, Ian","Educational programs for the 1 "MORSE, Peter (ed)","Microguide: "+c$,o,"1",e4,1.99 1 "MORSE, Peter & others","Century "+e$+" programming 1 "MORSE, Peter & HANCOCK, B.(eds)","Century "+e$+" programming 1 "MOORE, Lawrie","Mastering the ZX "+c$,o,"7Horwood85312",e3,n5,"700 X",i,d 1 "MONRO, Donald M","Know your "+c$,o,"8Tiny Pub907909",e4,n7,"03 5",i,d 1 "MONEY, Steve A",c$+" graphics & sound",vii,"5",e4,n6,"12192 0",i,d 1 "MOLE, Roy & FOX, Doug","Book of games and programs for 1 "MILLER, Judith","Beginning BASIC"+" with the ZX 1 "MERVYN, Tim & NEILSON, Dave","Beginner's BASIC"+" for the 1 "MATTHEWS, Toby & SMITH, Paul","Winning games on the ZX 1 "MARSHALL, Garry","BASIC for your ZX "+c$,iii,"5Arrow9",e4,n3,"937680 6",iv,o 1 "Loading code": 1 "Load DE with first screen byte address.","Load BC with number of bytes in one third of the screen.","Move all bytes on the top third of the screen one place back.","Go back to the start." 1 "Load BC with port address.","Fetch port into A.","Set ZERO FLAG if bit 0 of A is zero because Q is pressed." 1 "LUDOIDS #4" 1 "LUDINSKI, Genevieve","Brainteasers for the "+c$+" 1 "LORD, M.R.","Exploring "+c$+" BASIC",iii,"8Timedata907892",e2,n4,"03 5",i,d 1 "LOGAN, Ian",c$+" Microdrive book",iv,"9",e3,n5,"127 6",i,d 1 "LIVE WIRE" 1 "LINE?";A$(N,12 1 "LIMBERT, Ben","Guide to the "+c$,o,"0Designed P946246",e3,n2,"02 5",i,1.84 1 "LEWIS, Gareth & PORKESS, Roger",c$+" data log",o,"2",e4,n2,"197532 3",i,d 1 "LETTICE, John","Introducing your ZX "+c$,o,"7",e4,n3,"91602 X",ii,81284 1 "LETCHER, Piers","Step-by-step programming: ZX 1 "LAWRENCE, David","Working "+c$+": a library of 1 "LANGDELL, Tim",c$+" handbook",o,"1",e2,n5,"0152 X",i,d 1 "LAINE, David",c$+" machine code 1 "KRAMER, Steve",c$+" operating system",viii,"18",e4,n5,"0019 1",i,d 1 "JONES, Robin & FAIRHURST, M","Artificial intelligence: ZX 1 "JONES, Dilwyn","Beyond simple BASIC"+": delving 1 "JONES, Adrian","Programming arcade games for 1 "JOHNSON, W","50 subroutines for the "+d$+" "+c$,ii,"22",e4,n5,"97 8",i,d 1 "JAMES, Mike","Art of programming the ZX 1 "JACKSON, Peter","Business programming on your 1 "In which direction ?": 1 "INVALUABLE...","Invaluable utilities for the 1 "INGLIS, Jonathan","Facts and figures: "+c$+" ed",v,"5",e4,n1,"12588 8",iv,o 1 "Hi there !": 1 "HURLEY, Richard G","15 graphic games for the 1 "HURLEY, Randle","More real applications for the 1 "HURLEY, Linda",c$+" programming for young 1 "HUGHES, Carolyn","First steps with your "+c$,v,"6Armada00",e3,1.25 1 "HOORNAERT, Ed","Kid's manual for programming the"+d$+"/Timex "+e$+"s",v,"8Foulsham8306",e3,6.85 1 "HOLMES, Paul",c$+" machine code made easy.Vol 2. (See also: WALSH, James)",viii,"6",e3,n5,"44 9",i,d 1 "HAYWOOD, Daniel","Creating arcade games on your 1 "HAVILAND, Robert P","Computer companion for the 1 "HARWOOD, David","60 games and applications for 1 "HARTNELL, Tim","Dynamic games for the ZX 1 "HARTNELL, Tim & others","Educational uses of the ZX 1 "HARRISON, Mark",d$+" "+c$+" in focus",o,"22",e2,6.25 1 "HAMPSHIRE, Nick, (ed)",c$+" graphics",vii,"3",e2,n6,"1700 1",i,d 1 "GREENWOOD, Gareth","ZX cloak and dagger book. Codes and cryptography on "+d$+" 1 "GRAVES, Richard P. & GRAVES, D","ZX "+c$+". (Beginners Guides)",o,"0Kingfisher86272",e4,2.5 1 "GRANT, John & GRANT, Catherine","ZX programmer's guide",iii,"9Cambridge521",e4,n6,"27044 8",i,d 1 "GRAHAM, Natasha & ROBERTS, M","Micro"+e$+" hardware projects:"+d$+" "+c$+" & ZX81 add-on units",iv,"22",e4,n5,"64 1",i,d 1 "GRAHAM, Ian","Step by step programming: ZX 1 "GOH, K.S.","50 1k programs for primary 1 "GILES, Alan",c$+" Micronet book",o,"9",e4,n6,"167 5",ii,31184 1 "GIFFORD, Clive","Adventures for your "+c$,vi,"6Virgin86369",e4,n2,"060 2",i,d 1 "GERRARD, Peter","Advanced graphics for the 1 "GEE, S.M.",c$+" programmer",iii,"5",e2,n5,"12025 8",i,d 1 "GAVIN, Maurice","ZX "+c$+" astronomy: discover the heavens on your "+e$,ix,"12",e4,n6,"24 6",i,d 1 "GALLOWAY, Jim & CARNELL, Roy",c$+" music: making music on your micro",vii,"12",e4,n5,"25 4",i,d 1 "GABY, Ewin & GABY, Shirley","Gosubs: program-building sub- 1 "Following 1 "FROST, Jean","Instant arcade games for the 1 "FREEMAN, Richard","Step-by-step BASIC"+": ZX "+c$,iii,"8Lifelong946876",e4,n5,"01 0",i,d 1 "FIGCHESS.": 1 "FIGCHESS" 1 "FIG CODE" 1 "FIELD, Graham","Logo on the "+d$+" "+c$,v,"17",e5,n6,"38376 1",vi,o 1 "EXAMine things": 1 "EWBANK, Kay & others",c$+" gamesmaster",vi,"5",e4,n6,"12515 2",ii,11284 1 "ERSKINE, Robert","60 programs for the "+d$+" ZX "+c$,ii,"10",e3,n4,"28260 3",i,d 1 "ENTRY code ? (or 1 "ENTER top headline";a$ 1 "ENTER the word "; 1 "ENTER paper colour for bulletin";p 1 "ENTER ink colour";ink 1 "ENTER bulletin. You can include ink colour codes by presing capshift and a number when in extended mode.";b$ 1 "ENTER bottom line ";c$ 1 "ENTER background colour";back 1 "ELLERSHAW, Derek & SCHOFIELD, P",c$+" complete BASIC"+" course",iii,"9",e4,n9,"128 4",i,d 1 "ELKAN, David","Guide to playing ~ 1 "ED B0 LDIR 237,176" 1 "ED 78 IN A,(C) 237,120" 1 "Dumb move, you are kiled.": 1 "Do you want the instructions ? (Y/N)" 1 "DURST, John","Machine code sprites & graphics for the ZX "+c$,vii,"12",e4,n6,"51 3",i,d 1 "DURANG, David",c$+" graphics compendium",vii,"21",e4,n3,"02170 2",ii,110884 1 "DICKENS, Adrian",c$+" hardware manual",iv,"9",e3,n5,"115 2",i,d 1 "DEWHIRST, John & TENNISON, R","Child's guide to the ZX 1 "DETECTOR","BANANAS","BINOCULARS","CHEST","SAND" 1 "DEESON, Eric","Learning with the "+c$,v,"8AVC Soft946369",e2,ii,"01 1",i,d 1 "DALY, S.","20 programs for the ZX "+c$+" & 16k ZX81",ii,"14",e3,n1,"103 8",i,d 1 "CROSSWORD" 1 "CREATURESPECTRUMOMELETTEPANCREASTAPESTRYTARRAGONVOCATIONVIOLENCEDISSOLVEDISTINCTEXERCISEINTERNALNAVIGATENICOTINEOBEDIENTOCCASIONSYMPATHYSYMPHONYSYCAMOREDEMOLISHDIRECTORELEPHANTHALLMARKLAMINATEMAGNETICOPPOSITEPARAFFINPARTICLEPENTAGONADHESIVEALPHABETGULLIBLEINSULATEJAMBOREEKILOGRAMMANDOLINMARATHONNATIONALTERMINALUMBRELLACOCKTAILBIRTHDAYELECTIONBUSINESSORNAMENTFOUNTAINSQUIRRELPERIODICELECTRICDISTANCETOMORROWCALENDARMOUNTAINMAGAZINECOMPUTER" 1 "COOKE, Stuart","Companion to the "+d$+" ZX 1 "CONFUSED BAT RACE MAKES A FLOOR SHOW","DECEIVE, A YOUNG GOAT","A DUTCH LAWYER'S DUTCH COURAGE?","THE DOG WHICH TOOK DARWIN TO THEGALAPAGOS ISLANDS","A RULER FROM A REVERSED RASTA" 1 "COLUMN?";A$(N,14 1 "COATS, R.B.",c$+" BASIC",iii,"6Arnold7131",e3,n4,"3501 8",i,d 1 "CHARLTON, Mark","Action games for your ZX 1 "CHAPPLE, Jonathan","I wish I knew...about the 1 "CB 47 BIT 0,A 203,71" 1 "CARTER, Robert","Computer science tutor: 1 "CARTER, Graham","More games for your ZX "+c$,vi,"13",e3,3.5 1 "CAN'T GET OUT OF BED?","CAN'T WORK THE COMPUTER?","CAN'T FIND THE CREW MEMBER?","WHAT TO DO WITH THE LEOTARD?","HOW TO GET THE LANCE?","PAINT EVERYWHERE?","LASER PROBLEMS?": 1 "CAMACHO, Anthony","Drive your "+c$,o,"4",e3,n5,"01211 X",i,d 1 "CALLENDER, Chris","Putting your "+c$+" to work",i,"6",e3,n4,"40 6",i,d 1 "CAHILL, Pauline","Mathematical projects for the ZX"+c$,ix,"6",e4,n3,"55 4",i,d 1 "C9 RET 201" 1 "BULLETIN" 1 "BRIDGE, Tony, & CARNELL, Roy",c$+" adventures: a guide to playing & writing adventures",vi,"12",e3,n5,"07 6",i,d 1 "BRAIN, Keith & BRAIN, Steven","Artificial intelligence on the 1 "BRADBEER, Robin","Learning to use the ZX "+c$+".(See also next item)",o,"5Gower566",e2,n4,"03481 6",i,d 1 "BOWMAN, Marcus",c$+" advanced graphics 1 "BOON, Kaspar","Explorer's guide to the ZX 1 "BOOKLIST" 1 "BLUSTON, H.S.","Aerospace & communic'n satelliteapplic'ns of ZX81/"+c$+"..",ix,"9EnergyCon907350",e3,vii,"08 9",i,d 1 "BISHOP, Owen","Easy add-on projects for the 1 "BISHOP, Graham D",c$+" interfacing and 1 "BETTS, Steve",c$+" magic: your first 1 "BERT, A.A.","Practical robotics and inter- 1 "BERGIN, Kevin","Guide to writing games on the 1 "BEASLEY, Sue & CLARK, Ruth","Really easy guide to home 1 "BBIP","Bkslr","WCBL","No ref","advert","pub cat": 1 "BBIP = British Books in Print.WCBL = Whitaker's Cumulative 1 "BATESON, Spencer",c$+": "+e$+" crib card",o,"7Phoenix946576",e4,1.99 1 "BANKS, Rob","Machine code extensions for 1 "BAKER, Toni","Mastering machine code on your 1 "BAINS, Geoff","Better guide to the "+d$+" 1 "Are you sure ? Y/N"''"n.b. Press ""X"" to NEW this"'"program." 1 "ARDLEY, Neil","ZX "+c$+"+ user's guide",o,"0Kindersley86318",e4,n4,"080 9",ii,81284 1 "APPS, Vince","Learning is fun! 40 educational games for the "+c$,v,"5",e3,n5,"12233 1",i,d 1 "ANGELL, Ian O. & JONES, B.J.","Advanced graphics with the 1 "ANBARLIAN, Harry","Introduction to Vu-Calc spread- 1 "ALTWASSER, Richard F","Cambridge colour collection: 20 programs for the ZX "+c$,ii,"8(author)9507658",e2,n6,"2 1",i,d 1 "ALLAN, Boris","Building with Logo on the ZX 1 "ADAMS, Stephen","20 simple electronic projects 1 "ACROSS 0,DOWN 1,R REPEAT.";A$(N,18 1 ";d;" are probably out of print." 1 "9";"The": 1 "9";"PRESS ANY KEY" 1 "8","1","1000","2","2600","42","2520","43","2540","74","2540","32","2590","34","2590","35","2590" 1 "8"+FILE+((COL 1 "7Century7126","7Collins0","9Duckworth7156","8Foulsham572","7Granada246","9Interface907563","7Longman582","9McGraw-H.07","9Melbourne86161","3Pan330","5Shiva906812","8Sunshine946408","6Virgin907080","6Babani85934","6Browne946195","7Fontana0","9Macmillan333","8Micro Pr7447","3NEC86082","7Penguin14","6Pitman273","5Sigma905104" 1 "7";"Press Any Key": 1 "64001",LN: 1 "64000",FR+KK: 1 "6";"NEVER MIND, YOU GOT ";SC;" POINTS." 1 "6";"LOADING SOME CODE": 1 "6","21","3030","1","2500","8","3020","72","3030","73","3030","57","3030" 1 "6"*A,B-256 1 "6")="u")+("and Down" 1 "5";"To CASTLE merely move the king to its end position e.g:(E1-C1) " 1 "5";"A Figgins Production" 1 "5";" Do you want instuctions (y/n) " 1 "5","2","1000","3","2400","4","1600","6","1620","7","1620","42","1520" 1 "5")="w")+("up," 1 "41165",hb: 1 "41164",lb: 1 "4";"UNFORTUNATELY YOU WERE FRAZZLED TO A LITTLE BLACK CINDER! " 1 "4","2","1400","3","1500","6","1620","7","1620" 1 "4")="e"); 1 "3";"by Michael Silve"; 1 "3","1","2400","3","1460","4","1000" 1 "3")="s")+("East," 1 "26";"PQRS": 1 "24")="1": 1 "23658",o: 1 "23609",xx: 1 "23607",60 1 "23301",(k$="q")+2 1 "23300",16 1 "23298",(( 1 "23296")<256 1 "23296")*(( 1 "20 01 JR NZ, 1 "2")="n")+("South," 1 "19",o;" 1 "18"+n)="G" 1 "18"+M)=r$: 1 "18"+M)="G": 1 "18")="1": 1 "18 E9 JR 1 "17",vi;"for full screen output. 1 "17",o;" 1 "17")="1": 1 "16/48TITLE" 1 "16/48LOAD2" 1 "16/48LOAD1" 1 "16/48D&G17" 1 "16")="1": 1 "16"))'"scorpion"'"There is a ludoid jammer behind it": 1 "15",o;" 1 "15",i;"Press L to load ";: 1 "14";"END", 1 "13",v;"(Author & title only)."; 1 "13",o;" 1 "12",v;"for short screen output."; 1 "11";" ": 1 "11",o;" 1 "11","12","1050","7","1050","8","5670","1","1420","3","1000","45","1440","42","1430","4","1460","47","1090","48","1050","30","1490" 1 "11 00 40 LD DE,4000h 17,0,64" 1 "10";"PLAY THE TAPE": 1 "10";"Make a guess": 1 "10";"CIRCUIT ONE" 1 "10",i;"Press R to read again."; 1 "10","30","1490","8","1070","7","1050","1","1100","2","2500","3","2300","4","1400","47","1090","12","1050","48","1050" 1 "1";"PROMOTION."; 1 "1";" ": 1 "01 00,08 LD BC,800h 1,0,8" 1 "0";" Press {M} for menu of commands": 1 "0",XPR;"-";Z$;")": 1 "+e$,o,p$,e3,n5,"985028 7",i,d 1 "+d$+"/Timex "+e$+"s",o,"8Foulsham8306",e4,9.5 1 "+d$+" ZX "+c$,viii,"10",e4,n6,"28665 X",i,d 1 "+d$+" ZX "+c$,vii,"17",e3,n9,"35050 2",i,d 1 "+d$+" ZX "+c$,vi,"10",e3,n3,"28265 4",i,d 1 "+d$+" ZX "+c$,o,"20",e3,n5,"007803 7",i,d 1 "+d$+" ZX "+c$,ii,"10",e4,n5,"28663 3",iv,o 1 "+c$,vii,"3",e4,n6,"1865 2",ii,110884 1 "+c$,vi,"9E.Horwood85312",e4,n5,"734 4",i,d 1 "+c$,vi,"9Addison-W201",e3,n3,"14667 3",i,d 1 "+c$,vi,"8Sidgwick283",e4,n6,"99164 X",ii,171184 1 "+c$,vi,"6Virgin86369",e5,n2,"076 9",iv,o 1 "+c$,vi,"6Virgin86369",e5,n2,"073 4",iv,o 1 "+c$,vi,"6",e4,n4,"58 9",i,d 1 "+c$,vi,"6",e4,n4,"53 8",i,d 1 "+c$,vi,"3",e4,n6,"1884 9",ii,110884 1 "+c$,vi,"3",e4,n6,"1860 1",ii,110884 1 "+c$,vi,"18",e4,n5,s$,iv,o 1 "+c$,vi,"18",e3,n5,"0002 7",i,d 1 "+c$,vi,"16",e4,n3,"636699 6",i,d 1 "+c$,vi,"15",e3,n5,"13 7",i,d 1 "+c$,vi,"11",e4,n1,"28 3",vi,o 1 "+c$,vi,"1",e4,n3,"0624 6",vi,o 1 "+c$,v,"9Cambridge521",e3,n3,"27777 9",i,d 1 "+c$,v,"12",e4,n6,"39 4",iv,o 1 "+c$,v,"1",e3,n6,"0260 7",i,d 1 "+c$,o,"6Futura7088",e3,n2,"2442 0",i,d 1 "+c$,o,"5Zomba946391",e4,n3,"47 5",i,d 1 "+c$,o,"3",e4,n2,"1789 3",i,d 1 "+c$,o,"1",e5,n7,"0657 2",vi,o 1 "+c$,ix,"5Shiva85014",e4,n5,"026 X",vi,o 1 "+c$,iii,"17",e4,n5,"37995 0",vi,o 1 "+c$,iii,"14",e2,n2,"094 5",i,d 1 "+c$,iii,"11",e3,n5,"24 0",i,d 1 "+c$,ii,"1",e3,n5,"0262 3",i,d 1 "+c$,ii,"0Prentice-H13",e3,n6,"634766 5",i,d 1 "+c$+": make your micro think",o,"12",e4,n6,"37 8",i,d 1 "+c$+": a guide book for 1 "+c$+". Book 2",o,p$,e4,n4,"037 5",ii,241184 1 "+c$+". Book 2",iii,p$,e4,n6,"031 0",i,d 1 "+c$+". Book 1",o,"5Shiva85014",e4,n4,"033 2",ii,241184 1 "+c$+". Book 1",iii,"0Kindersley86318",e4,n6,"026 4",i,d 1 "+c$+". 3rd rev ed",iii,"7Glentop907792",e4,10.5 1 "+c$+", ZX81 & Ace",iv,"14",e3,2.75 1 "+c$+"+: graphics. Book 4",vii,"0Kindersley86318",e4,n5,"104 X",v,o 1 "+c$+"+: graphics. Book 3",vii,"0Kindersley86318",e4,n5,"087 6",v,o 1 "+c$+"+. Book 2",iii,p$,e4,n5,"096 5",ii,81284 1 "+c$+"+. Book 1",iii,p$,e4,n5,"095 7",ii,81284 1 "+c$+" BASIC",viii,"6Hewson0",e4,n6,s$,v,o 1 "+c$+" 48k",vi,"3",e4,n6,"1796 6",i,d 1 "+c$+" 48k",vi,"18",e4,n5,"0013 2",i,d 1 "+c$+" & ZX81",vi,"11",e2,2.5 1 "+c$+" & ZX81",o,"9Addison-W201",e3,n7,"14638 X",i,d 1 "+c$+" & ZX81",iii,"16",e3,3.5 1 "+c$+" & ZX81",o,"21",e3,n4,"02029 3",i,d 1 "+c$+" "+e$,i,"7Phoenix946576",e4,n6,"05 X",i,d 1 "(prog+593)": 1 "(PROG+361)" 1 "'''"Follow the prompts and when the picture is displayed press"''" 1 "''"You can now continue your quest."'"Write this code on the inlay"'"card so that you can start the next episode" 1 "''"The first 10 correct tapes drawnon 15th JUNE win ""WIZARD'S LAIR""plus a 1 "''"Cursor"'"keys"'"move *"''" 1 "'"When you see the picture use keys 1 "'"This time the high byte of the address is from the A register and the low byte is N. The data goes into the A register." 1 "'"The Z80 selects input/output, acivates the READ line and puts the contents of the BC register pair onto the address bus. The data put onto the data bus then goes to r (A,B,C,D,E,H or L)." 1 "'"If it does not verify type GOTO GO": 1 "'"1480 PRINT AT 10,10;x:GOTO 1460" 1 "'" We will pay `10 for published letters or between `20 and `100 if you can send us an original program which we can feature."'"(Please enclose a SAE if you want your tape returned.)"''" Meanwhile enjoy the rest of the tape....": 1 ""a""-768"'"CLEAR x-1:LOAD"""" 1 " WELL DONE " 1 " ": 1 " ": 1 " 1 !NIGHT DRIVING ? 1 you will return to this page and the picture will remain as you left it."''"Press 1 y =last 2 year-digits 1 took overthe inlay card presentation has gone downhill." 1 to"'"answer a"'"clue."''" 1 to turn back a page,"''" Any other key to page through the review."'''"The display will stay on the screen for as long as you hold a key down."''"Don't forget 1 to save the program to a blank tape"''" 1 to save the picture to tape and send (together with Teeshirt size (s,m,l or xl) to;-" 1 to run the program againPress 1 to read again."; 1 to quit."''" 1 to quit and move on,"''" 1 to quit & load the ADVENTURE.": 1 to produce the unscrambled screen."''"If you press 1 to page backwards."''''" 1 to move on." 1 to escape." 1 to any category, and theprogram will stop." 1 to NEW it" 1 title : ";((r$+y$)( 1 then a vital confirmation of an alibican be obtained." 1 takeover of the dear ol' mag."''" 1 subject : ";w$(u+ii); 1 some coordinates !": 1 saves to Microdrive"''" 1 s =subject code no. 1 publisher: ";((v$+y$)( 1 problems.": 1 p$=publisher (inc ISBN prefix) 1 on all categories tolist the entire file. 1 on SIDE 2."''"Press 1 of register 1 is the first part of 1 is an excellent 1 if Q not pressed.","RETURN to Basic if Q is pressed.","LD HL with second screen byte address." 1 i$=ISBN suffix 1 from his London lodgings one Monday night Holmes overheard him taking a cab to 1 for hard copy)" 1 exceptional 1 db=date of bibliog ref. 1 check for page length 1 changes"'"mode"'"(across or"'"down)"''"Press"'" 1 b =bibliog ref code no. 1 author : ";((q$+y$)( 1 around thecircuits collecting the Diodes (you score 10ptsfor each). Unfortunately, someone is switching the power on and off at regular intervals." 1 any other key to continue... 1 alone, to list thewhole file within author/subject/publisher limits. 1 alone to list whole file withinauthor/title/publisher limits. 1 a$=author 1 TAKE OFF"'" 1 TAKE OFF 1 Special Commands" 1 Sleuths corner. 1 STOP THE TAPE 1 SEARCH KEYS:"; 1 SCROLLING 1 QUITS"''" 1 Press Z to copy, 1 Press ""ENTER"" for another word "; 1 NEVER MIND ": 1 More than 4 letter words"; 1 It seems that the adventure 1 If hard- copy is cut every 15 records, 1 INSTRUCTIONS 1 How to play the game" 1 He decided to 1 Entry code; 1 DON'T RUN OR CLEAR:GOTO 1.": 1 Change length 1 CLOSELY EXAMINE DRAWER "'" 1 BULLETIN 1 Any length words" 1 Already guessed ": 1 7 & 8 ";b$; 1 7 ""LUDOIDS#4""* 1 6 ""tutor8"" 1 5 & 6 ";b$; 1 5 ""CUSTARD"" 1 4 ""edit"" 1 3 & 4 ";b$; 1 3 ""micro"" 1 2 ""letter""* 1 16/48 Magazine/John Luby 1 **16/48 issue 18** 1 (also up&down the way)"' 1 (1Fh)(0001111 in binary)" 1 %TUVWXY"; 1 ";pt;" record";("s" 1 !";"""";" 1 to quit, or press 1 to list all of acategory, subject to limits setby the other categories. 1 alone, to list thewhole file within author/subject/title limits. 1 alone to list thewhole file within title/subject/publisher limits. 1 Yet another excellent maths education program from A.S.K. & Psion. Thisis a fast moving arcade game which encourages itsplayers to develop the skills of combining different mathematical operations (+-*/) to 1 START OF MAIN PROGRAM 1 SEARCH KEY HEADING ROUTINE 1 PUBLISHER 1 OUTPUT CHOICE ROUTINE 1 INTRODUCTION & INSTRUCTIONS 1 INITIALISE 1 I have found a use for the 1 HEX ASSEMBLY DECIMAL 1 HARDCOPY HEADINGS 1 BIGPRINT ROUTINE 1 !";""""; 1 !";""" "; 1 loads and add these two lines tothe short BASIC loader."'"15 POKE 30371,108"'"16 POKE 30349,0"''"Then RUN and load the rest." 1 WEAR OLD MANS 1 The majority of educational programs thatI see are poorly designedalmost always written in BASIC and boring. So a well designed, machine coded, educational program which is fun was a refreshing surprise. 1 BY: S Marsden & D Cooke PRICE: `5.95 Hewson Consultants Ltd Hewson House 56B Milton Trading Est. Abingdon Oxon OX14 4RX. 1 SPECTRUM BOOKLIST 1 PRICE: `6.95 FROM: GREMLIN GRAPHICS Alpha House 10 Carver Street Sheffield S1 4FS. 1 PRICE: `5.95 PUBLISHER: ROMANTIC ROBOT77 Dyne Road London NW6 7DR. 1 Another list? 1 ADVENTURE HELP FROM Yaz. " 1 "Oh-hum, here we go again" I thought, expecting the usual Jet Set Willy clone. A few seconds into loading and this program had all my attention. Ten well animated men were now marching across the 1 PRICE: `6.95 PUBLISHER: INSIGHT 117 Higher Parr Street The Finger Post Shopping Centre St Helens Merseyside WA9 1AG. 1 CHINA MANS DISGUISE!" 1 Any other key continues. 1 32,1" 1 by John Luby. 1 Jan 1985 1 24,233" 1 "THREE..TWO...ONE...GO!" ..and with a single shot from the starter's gun the four regional champions of the annual Maggot Marathon bite their lips and quickly set off on the most dangerous event of the 1 seller's advertisement.Pub cat= Publisher's catalogue. No Ref = No formal bibliograph- ical reference, provis- ional listing." 1 Booklist. 1 '88888888' 1 Program by Barry Thorne Graphics by Jim Dann 1 1 1 1 1 1 1 1